Description
LL-37 cap-18 5mg Pre-Mixed Pen – Pharmagrade store India
LL-37 cap-18 pre-mixed pen is an antibacterial peptide used to treat bacterial infections. Research has shown it is a member of the catatonic family of antimicrobial peptides found in humans.
LL-37 is a pharmaceutical peptide used to treat bacterial infections. Although its mechanism of function is derived from the innate LL-37, it has the potential to fight against both Gram-negative and Gram-positive bacteria. Research has suggested that it is one of the best antibacterial medications.
LL-37 has the potential to fight against bacteria, viruses, and fungi; including yeast infections. LL-37 cap-18 pre-mixed pen has also been shown to stop the viral function of the herpes simplex virus. Also, scientific investigations have uncovered it reduces viral replication in the vaccinia (smallpox) virus.
This peptide can also function as a chemo-attractant for immune cells, large amounts of innate LL-37 are found in infection sites because they attract the white blood cells to the infection sites.
Furthermore, LL-37 studies have demonstrated it could bind and neutralize lipopolysaccharides; this is beneficial because of LPS from the outermost membrane of Gram-negative bacteria.
LL-37 cap-18 pre-mixed pen could bind and neutralize the LPS on top of the gram-negative bacteria, the bacteria will not be protected. In turn, this will lead to the elimination of the bacteria.
LL-37 is also helpful in wound healing. Higher levels of LL-37 cap-18 Peptide are usually found in a wound, which often reduces after wound closure; scientists believe this shows that it helps in wound healing.
Also, higher amounts of LL-37 are found on the reforming epithelium of the wound, which means it also helps form the epithelium back.
Benefits of LL-37 cap-18 5mg Pre-mixed Pen:
Research has revealed the following benefits:
- Ability to fight bacteria, viruses & fungi. Including yeast infections and herpes simplex virus.
- Antimicrobial Functions
- Acts as a chemo-attractant
- Binding and neutralizing LPS
- Re-epithelialization and wound closure
Amino Acid Sequence:Â [LL-37, 37 aa]
Molecular Formula:Â C205H340N60O53
References:
https://pubmed.ncbi.nlm.nih.gov/16493063/
Benefits of Pharma Grade Store Pre-mixed Peptide Pens
Pre-mixed pen kits include a cartridge, have a dosage dial, and single-use needle tips inside the case. As a result, pens are easier, more accurate, and more convenient than a vial and syringe. Single cartridges can be used to top up your kit.
Other benefits include:
- Usability, especially for those new to research peptides.
- The pens are portable and convenient.
- The ability to set doses precisely using a dial.
- Reduces the stress of mixing correctly
- Because they are pre-mixed, they save time.
- There are various accessories to facilitate storage and use.
DISCLAIMER: We do not supply Peptides or Sarms to any individual under the age of 21. You must be a licensed and qualified healthcare practitioner. All products listed on this website (https://ind.pharmagrade.store) and provided through Pharma Grade are intended ONLY FOR medical research purposes. Pharma Grade India does not encourage or promote the use of any of these products in a personal capacity (i.e. human consumption) nor are the products intended as a drug, stimulant or for use in any food products.